Structure of PDB 7evs Chain A Binding Site BS01

Receptor Information
>7evs Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMVEFE
SVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPY
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7evs Structural basis of the interaction between SETD2 methyltransferase and hnRNP L paralogs for governing co-transcriptional splicing.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y178 A224 N226 A228 D229 I230 Y231 A232
Binding residue
(residue number reindexed from 1)
Y15 A61 N63 A65 D66 I67 Y68 A69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7evs, PDBe:7evs, PDBj:7evs
PDBsum7evs
PubMed34750379
UniProtQ8WVV9|HNRLL_HUMAN Heterogeneous nuclear ribonucleoprotein L-like (Gene Name=HNRNPLL)

[Back to BioLiP]