Structure of PDB 7et4 Chain A Binding Site BS01

Receptor Information
>7et4 Chain A (length=102) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAASSYDIAVR
RFRGRDAVTNFKSQVDGNDAESAFLDAHSKAEIVDMLRKHTYADEFEQSR
RK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et4 TEM1 combinatorially binds to FLOWERING LOCUS T and recruits a Polycomb factor to repress the floral transition in Arabidopsis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Q78 N80 R82 R93 W95 T98
Binding residue
(residue number reindexed from 1)		Q14 N16 R18 R29 W31 T34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7et4, PDBe:7et4, PDBj:7et4
PDBsum7et4
PubMed34446554
UniProtQ9C6M5|RAVL1_ARATH AP2/ERF and B3 domain-containing transcription repressor TEM1 (Gene Name=TEM1)

[Back to BioLiP]