Structure of PDB 7enj Chain A Binding Site BS01

Receptor Information
>7enj Chain A (length=467) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKMSSLLERLHAKFWSETIKLVRQVMEKQHLVSCLETLQKALKVTSLPA
MTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVHHGENPVSCPELVQ
QLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIM
YWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDIILHEN
NVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFNSVDLPA
CFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKD
PDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHP
GRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFS
VSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRC
MSIPVTMRAIRRKAETI
Ligand information
>7enj Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7enj Structures of the human Mediator and Mediator-bound preinitiation complex.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		R500 R509
Binding residue
(residue number reindexed from 1)		R449 R458
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030331 nuclear estrogen receptor binding
GO:0030374 nuclear receptor coactivator activity
GO:0031490 chromatin DNA binding
GO:0035035 histone acetyltransferase binding
GO:0042809 nuclear vitamin D receptor binding
GO:0042974 nuclear retinoic acid receptor binding
GO:0042975 peroxisome proliferator activated receptor binding
GO:0044877 protein-containing complex binding
GO:0046966 nuclear thyroid hormone receptor binding
GO:0050693 LBD domain binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061630 ubiquitin protein ligase activity
GO:0140296 general transcription initiation factor binding
GO:0140297 DNA-binding transcription factor binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000902 cell morphogenesis
GO:0001525 angiogenesis
GO:0001701 in utero embryonic development
GO:0001889 liver development
GO:0001892 embryonic placenta development
GO:0002088 lens development in camera-type eye
GO:0002154 thyroid hormone receptor signaling pathway
GO:0003222 ventricular trabecula myocardium morphogenesis
GO:0003406 retinal pigment epithelium development
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006590 thyroid hormone generation
GO:0006606 protein import into nucleus
GO:0006702 androgen biosynthetic process
GO:0007420 brain development
GO:0007507 heart development
GO:0007595 lactation
GO:0008284 positive regulation of cell population proliferation
GO:0009887 animal organ morphogenesis
GO:0010628 positive regulation of gene expression
GO:0010839 negative regulation of keratinocyte proliferation
GO:0016567 protein ubiquitination
GO:0030216 keratinocyte differentiation
GO:0030224 monocyte differentiation
GO:0030518 nuclear receptor-mediated steroid hormone signaling pathway
GO:0031100 animal organ regeneration
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway
GO:0033598 mammary gland epithelial cell proliferation
GO:0035050 embryonic heart tube development
GO:0035116 embryonic hindlimb morphogenesis
GO:0035162 embryonic hemopoiesis
GO:0035357 peroxisome proliferator activated receptor signaling pathway
GO:0035729 cellular response to hepatocyte growth factor stimulus
GO:0035855 megakaryocyte development
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043010 camera-type eye development
GO:0043066 negative regulation of apoptotic process
GO:0045023 G0 to G1 transition
GO:0045444 fat cell differentiation
GO:0045618 positive regulation of keratinocyte differentiation
GO:0045648 positive regulation of erythrocyte differentiation
GO:0045665 negative regulation of neuron differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048821 erythrocyte development
GO:0048822 enucleate erythrocyte development
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060218 hematopoietic stem cell differentiation
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:0060335 positive regulation of type II interferon-mediated signaling pathway
GO:0060744 mammary gland branching involved in thelarche
GO:0060745 mammary gland branching involved in pregnancy
GO:0060750 epithelial cell proliferation involved in mammary gland duct elongation
GO:0070318 positive regulation of G0 to G1 transition
GO:0070562 regulation of vitamin D receptor signaling pathway
GO:0071364 cellular response to epidermal growth factor stimulus
GO:0071383 cellular response to steroid hormone stimulus
GO:0097067 cellular response to thyroid hormone stimulus
GO:2000347 positive regulation of hepatocyte proliferation
GO:2001141 regulation of RNA biosynthetic process
Cellular Component
GO:0000151 ubiquitin ligase complex
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0016020 membrane
GO:0016592 mediator complex
GO:0032993 protein-DNA complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7enj, PDBe:7enj, PDBj:7enj
PDBsum7enj
PubMed33958484
UniProtQ15648|MED1_HUMAN Mediator of RNA polymerase II transcription subunit 1 (Gene Name=MED1)

[Back to BioLiP]