Structure of PDB 7el3 Chain A Binding Site BS01

Receptor Information
>7el3 Chain A (length=138) Species: 470 (Acinetobacter baumannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIRPSLTLALLEAREAIMSHFRPALNEVGLTEQQWRIIRILYQYEELESN
QLAELACILKPSLTGILNRMVEQKLIQKRKDYDDQRISLISLTESGLECF
KTQAVKMEASYQKIQEQYGEEKMKQLLELLKDLSKIKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7el3 Mechanism of transcription regulation by Acinetobacter baumannii HpaR in the catabolism of p-hydroxyphenylacetate.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R24 N28 S51 N52 K62 P63 T66 R88 I89 S90
Binding residue
(residue number reindexed from 1)		R22 N26 S49 N50 K60 P61 T64 R86 I87 S88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7el3, PDBe:7el3, PDBj:7el3
PDBsum7el3
PubMed34967505
UniProtA0A4Q4GPX4

[Back to BioLiP]