Structure of PDB 7ejn Chain A Binding Site BS01

Receptor Information
>7ejn Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFG
CDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAA
HVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ejn Identification of TCR repertoires in functionally competent cytotoxic T cells cross-reactive to SARS-CoV-2.
Resolution2.11 Å
Binding residue
(original residue number in PDB)
Y7 E62 E63 K66 V67 H70 T73 E76 N77 I80 Y84 F99 T143 W147 Q155 Q156 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)
Y7 E62 E63 K66 V67 H70 T73 E76 N77 I80 Y84 F99 T143 W147 Q155 Q156 Y159 T163 Y171
Enzymatic activity
Enzyme Commision number ?
External links