Structure of PDB 7eic Chain A Binding Site BS01

Receptor Information
>7eic Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eic Elucidation of binding preferences of YEATS domains to site-specific acetylated nucleosome core particles.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		H56 E57 S58 F59 G77 Y78 A79 G80 L106
Binding residue
(residue number reindexed from 1)		H56 E57 S58 F59 G77 Y78 A79 G80 L106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7eic, PDBe:7eic, PDBj:7eic
PDBsum7eic
PubMed35732209
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]