Structure of PDB 7egd Chain A Binding Site BS01

Receptor Information
>7egd Chain A (length=620) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WRYGPARLWYDMLGVPEDDLLADENFLMVTQLHWEDDIIWDGEPWYSIFP
IDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILPWNLSNDE
YYYPKIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPG
PHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAE
YSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLG
SLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVV
GQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKK
AFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSP
EQCCAYYSMIAAEQRLKDAGDDEVRTAPWNTTRAFIAAMKGKCLLEVTGV
ADPTGCGEGFSYVKIPNKDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRW
EVIDVVRTMSTERFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDATG
RCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFHREEMRK
ERRRIQEQLRRLKRNQEKEK
Ligand information
>7egd Chain X (length=72) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctataaaagggggtgggggcgcgttcgtcctcagtcgcgatcgaacactc
gagccgagcagacgtgcctacg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7egd Structural insights into preinitiation complex assembly on core promoters.
Resolution6.75 Å
Binding residue
(original residue number in PDB)		R804 R854 D992 R996 R1022 W1023 D1027 R1030 R1226 Q1230 R1233
Binding residue
(residue number reindexed from 1)		R322 R372 D469 R473 R499 W500 D504 R507 R604 Q608 R611
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001181 RNA polymerase I general transcription initiation factor activity
GO:0002039 p53 binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016301 kinase activity
GO:0016746 acyltransferase activity
GO:0016922 nuclear receptor binding
GO:0017025 TBP-class protein binding
GO:0043565 sequence-specific DNA binding
GO:0044024 histone H2AS1 kinase activity
GO:0046982 protein heterodimerization activity
GO:0061628 H3K27me3 modified histone binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061631 ubiquitin conjugating enzyme activity
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0070577 lysine-acetylated histone binding
GO:0106310 protein serine kinase activity
GO:0140416 transcription regulator inhibitor activity
GO:0140566 histone reader activity
GO:1905502 acetyl-CoA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000209 protein polyubiquitination
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006468 protein phosphorylation
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006974 DNA damage response
GO:0010629 negative regulation of gene expression
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0018107 peptidyl-threonine phosphorylation
GO:0030901 midbrain development
GO:0032092 positive regulation of protein binding
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034644 cellular response to UV
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046777 protein autophosphorylation
GO:0050821 protein stabilization
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
GO:0071318 cellular response to ATP
GO:1901796 regulation of signal transduction by p53 class mediator
GO:1902806 regulation of cell cycle G1/S phase transition
GO:1905524 negative regulation of protein autoubiquitination
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005669 transcription factor TFIID complex
GO:0005730 nucleolus
GO:0071339 MLL1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7egd, PDBe:7egd, PDBj:7egd
PDBsum7egd
PubMed33795473
UniProtP21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 (Gene Name=TAF1)

[Back to BioLiP]