Structure of PDB 7ef2 Chain A Binding Site BS01

Receptor Information
>7ef2 Chain A (length=148) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWI
NVRKCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRR
RHDVGGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ef2 Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S140 R142 Y147 D148 F172 R189 P192 E194 E197 F210 Q216 A217 L218 Y219 R257
Binding residue
(residue number reindexed from 1)		S10 R12 Y17 D18 F42 R59 P62 E64 E67 F80 Q86 A87 L88 Y89 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:7ef2, PDBe:7ef2, PDBj:7ef2
PDBsum7ef2
PubMed33913587
UniProtB7ZYP9

[Back to BioLiP]