Structure of PDB 7ef0 Chain A Binding Site BS01

Receptor Information
>7ef0 Chain A (length=147) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINV
RKCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRRRH
DVRGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ef0 Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		S133 Y147 D148 F172 R189 P192 E194 E197 F210 E212 D215 Q216 A217 Y219
Binding residue
(residue number reindexed from 1)		S1 Y15 D16 F40 R57 P60 E62 E65 F78 E80 D83 Q84 A85 Y87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:7ef0, PDBe:7ef0, PDBj:7ef0
PDBsum7ef0
PubMed33913587
UniProtB7ZYP9

[Back to BioLiP]