Structure of PDB 7ea1 Chain A Binding Site BS01

Receptor Information
>7ea1 Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCV
YGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGS
KDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSD
SLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ea1 Molecular basis for SPINDOC-Spindlin1 engagement and its role in transcriptional inhibition
Resolution2.7 Å
Binding residue
(original residue number in PDB)		D95 C96 F141 W151 D173 Y177 D250 H252
Binding residue
(residue number reindexed from 1)		D48 C49 F94 W104 D126 Y130 D189 H191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:7ea1, PDBe:7ea1, PDBj:7ea1
PDBsum7ea1
PubMed
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]