Structure of PDB 7e74 Chain A Binding Site BS01

Receptor Information
>7e74 Chain A (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFW
LHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDL
FLNLEGKVNHLRCEKLTFNNPTTEFRYKLLRAGGVMV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e74 Hotspot mutations in the structured ENL YEATS domain link aberrant transcriptional condensates and cancer.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H56 F59 G77 Y78 A79 G80 D103
Binding residue
(residue number reindexed from 1)		H52 F55 G73 Y74 A75 G76 D99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7e74, PDBe:7e74, PDBj:7e74
PDBsum7e74
PubMed36272410
UniProtQ03111|ENL_HUMAN Protein ENL (Gene Name=MLLT1)

[Back to BioLiP]