Structure of PDB 7e0b Chain A Binding Site BS01

Receptor Information
>7e0b Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGA
ADRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e0b SNX27 suppresses SARS-CoV-2 infection by inhibiting viral lysosome/late endosome entry.
Resolution1.29 Å
Binding residue
(original residue number in PDB)		G52 Y53 G54 F55 N56 V57 R58 G59 Q60 V61 H114 V118 I121
Binding residue
(residue number reindexed from 1)		G13 Y14 G15 F16 N17 V18 R19 G20 Q21 V22 H75 V79 I82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7e0b, PDBe:7e0b, PDBj:7e0b
PDBsum7e0b
PubMed35022217
UniProtQ96L92|SNX27_HUMAN Sorting nexin-27 (Gene Name=SNX27)

[Back to BioLiP]