Structure of PDB 7dzn Chain A Binding Site BS01

Receptor Information
>7dzn Chain A (length=277) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP
WIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
RVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEPS
Ligand information
>7dzn Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TPQDLNTML
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dzn Cross-reactive TCR with alloreactivity for immunodominant HIV-1 epitope Gag TL9 with enhanced control of viral infection
Resolution2.63 Å
Binding residue
(original residue number in PDB)
Y9 N65 Y69 Q72 T75 S79 N82 Y86 Y101 T145 W149 Q157 Y161 W169 Y173
Binding residue
(residue number reindexed from 1)
Y7 N63 Y67 Q70 T73 S77 N80 Y84 Y99 T143 W147 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links