Structure of PDB 7dzm Chain A Binding Site BS01

Receptor Information
>7dzm Chain A (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRA
PWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMY
GCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEA
ARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEA
TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVV
PSGEEQRYTCHVQHEGLPKPLTLRWEPS
Ligand information
>7dzm Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TPQDLNTML
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dzm Cross-reactive TCR with alloreactivity for immunodominant HIV-1 epitope Gag TL9 with enhanced control of viral infection
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y9 R64 N65 I68 Y69 Q72 T75 S79 N82 Y86 Y101 Y118 S145 K148 Q157 L158 Y161 W169 Y173
Binding residue
(residue number reindexed from 1)		Y8 R63 N64 I67 Y68 Q71 T74 S78 N81 Y85 Y100 Y117 S144 K147 Q156 L157 Y160 W168 Y172
Enzymatic activity
Enzyme Commision number ?
External links