Structure of PDB 7dwh Chain A Binding Site BS01

Receptor Information
>7dwh Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT
Ligand information
>7dwh Chain X (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaccuacuacgagcgccauugcacuccggcgccacggggggucc
<<<<<<.<<.<<.<<<<<..........>>>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dwh The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y13 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N11 E14 K17 L44 K45 M46 R47 Q49 F51 K75 A82 K83 T84 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7dwh, PDBe:7dwh, PDBj:7dwh
PDBsum7dwh
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]