Structure of PDB 7dvv Chain A Binding Site BS01

Receptor Information
>7dvv Chain A (length=139) Species: 211110 (Streptococcus agalactiae NEM316) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSI
KDAEEILHISKSVASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQK
ATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dvv Heme controls the structural rearrangement of its sensor protein mediating the hemolytic bacterial survival.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		P34 S62 S64 V65 R72 D87 K88 R89
Binding residue
(residue number reindexed from 1)		P32 S60 S62 V63 R70 D85 K86 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dvv, PDBe:7dvv, PDBj:7dvv
PDBsum7dvv
PubMed33850260
UniProtQ8E4J9

[Back to BioLiP]