Structure of PDB 7duu Chain A Binding Site BS01

Receptor Information
>7duu Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPW
VEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGC
DLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAR
EAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATL
RCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPS
GEEQRYTCHVQHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7duu Activating receptor KIR2DS2 bound to HLA-C1 reveals the novel recognition features of activating receptor.
Resolution2.51 Å
Binding residue
(original residue number in PDB)		Y7 F9 E63 K66 Y67 Q70 T73 S77 N80 Y84 W97 Y123 T143 W147 E152 R156 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y6 F8 E62 K65 Y66 Q69 T72 S76 N79 Y83 W96 Y122 T142 W146 E151 R155 Y158 Y170
Enzymatic activity
Enzyme Commision number ?
External links