Structure of PDB 7du5 Chain A Binding Site BS01

Receptor Information
>7du5 Chain A (length=117) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPV
TSNIAKVYPFQVLLSATTTGLQVDCKAQAEQIRSIATERLLRPIGRVSAA
ELAQLDEALKLHLDLWS
Ligand information
>7du5 Chain C (length=15) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TLEDDYANAWQEWSA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7du5 Mechanistic Insight into the Peptide Binding Modes to Two M. tb MazF Toxins.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R24 N54 Y59 P60 F61 K77 H113
Binding residue
(residue number reindexed from 1)		R23 N53 Y58 P59 F60 K76 H112
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0006402 mRNA catabolic process
GO:0016075 rRNA catabolic process
GO:0044003 symbiont-mediated perturbation of host process
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7du5, PDBe:7du5, PDBj:7du5
PDBsum7du5
PubMed33925254
UniProtP71650|MAZF9_MYCTU Endoribonuclease MazF9 (Gene Name=mazF9)

[Back to BioLiP]