Structure of PDB 7dta Chain A Binding Site BS01

Receptor Information

>7dta Chain A (length=33) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDAKKCRKVYGMERRDLWCTACRWKKACQRFLD

Ligand information

>7dta Chain B (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatgccgggac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7dta Selective Nonmethylated CpG DNA Recognition Mechanism of Cysteine Clamp Domains.
Resolution	N/A
Binding residue (original residue number in PDB)	K359 R361 K362 K379 K380 A381 C382
Binding residue (residue number reindexed from 1)	K5 R7 K8 K25 K26 A27 C28

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7dta, PDBe:7dta, PDBj:7dta
PDBsum	7dta
PubMed	33983734
UniProt	Q9NR83\|S2A4R_HUMAN SLC2A4 regulator (Gene Name=SLC2A4RG)

[Back to BioLiP]