Structure of PDB 7dng Chain A Binding Site BS01

Receptor Information
>7dng Chain A (length=161) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHGSDLGKKLLEAARAGQDDEVRILMANGADVNANDVYGITPLHLAAYMG
HLEIVEVLLKYGVDVNASDQFGNTPLHLAADDGHLEIVEVLLKHGTDVNA
TDTWGSTPLHLAAHRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGN
EDLAEILQKLN
Ligand information
>7dng Chain B (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dng Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.42 Å
Binding residue
(original residue number in PDB)		R23 Y46 I48 H52 Y56 D77 F79 N81 L86 D89 D90 D110 T111 W112 L119 R123
Binding residue
(residue number reindexed from 1)		R15 Y38 I40 H44 Y48 D69 F71 N73 L78 D81 D82 D102 T103 W104 L111 R115
External links