Structure of PDB 7dnf Chain A Binding Site BS01

Receptor Information
>7dnf Chain A (length=158) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHGSDLGKKLLEAARAGQDDEVRILMANGADVNANDVYGITPLHLAAYMG
HLEIVEVLLKYGVDVNASDQFGNTPLHLAADDGHLEIVEVLLKHGTDVNA
TDTWGSTPLHLAAHRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGN
EDLAEILQ
Ligand information
>7dnf Chain B (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTTPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dnf Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		R23 Y46 I48 H52 Y56 M57 D77 F79 N81 L86 D89 D90 W112 R123
Binding residue
(residue number reindexed from 1)		R15 Y38 I40 H44 Y48 M49 D69 F71 N73 L78 D81 D82 W104 R115
External links