Structure of PDB 7dlz Chain A Binding Site BS01

Receptor Information
>7dlz Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQ
AFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT
Ligand information
>7dlz Chain X (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaccuacuacgagcgccauugcacuccggcgccacggggggucc
.<<<<<.<<.<<.<<<<<..........>>>>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dlz The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences
Resolution3.002 Å
Binding residue
(original residue number in PDB)		Y13 N16 E19 K22 S48 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y9 N12 E15 K18 S44 L45 K46 M47 R48 Q50 F52 K76 Q81 A83 K84 D86 S87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7dlz, PDBe:7dlz, PDBj:7dlz
PDBsum7dlz
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]