Structure of PDB 7df9 Chain A Binding Site BS01

Receptor Information
>7df9 Chain A (length=360) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVY
VTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERL
IKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENL
EEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLD
KEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVA
MEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASST
LLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHP
KPKEEPPPEH
Ligand information
>7df9 Chain V (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RTPPSLGPSCTTASSSLRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7df9 Structural studies of phosphorylation-dependent interactions between the V2R receptor and arrestin-2.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		T6 R7 V8 F9 K10 R62 T74 R76 R103 K107 R165 L166 K294
Binding residue
(residue number reindexed from 1)		T2 R3 V4 F5 K6 R58 T70 R72 R99 K103 R161 L162 K290
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000822 inositol hexakisphosphate binding
GO:0001664 G protein-coupled receptor binding
GO:0005515 protein binding
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
GO:0030276 clathrin binding
GO:0032050 clathrin heavy chain binding
GO:0033130 acetylcholine receptor binding
GO:0035612 AP-2 adaptor complex binding
GO:0036094 small molecule binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007165 signal transduction
GO:0007601 visual perception
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0031623 receptor internalization
GO:0045746 negative regulation of Notch signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0072583 clathrin-dependent endocytosis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0030132 clathrin coat of coated pit
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7df9, PDBe:7df9, PDBj:7df9
PDBsum7df9
PubMed33888704
UniProtP17870|ARRB1_BOVIN Beta-arrestin-1 (Gene Name=ARRB1)

[Back to BioLiP]