Structure of PDB 7dee Chain A Binding Site BS01

Receptor Information

>7dee Chain A (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MGRSDSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRE
RGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVL
MAEIGEDLDKSDVSSLIGLMKDYMGRGKISKEKSFLDLVVELEKLNLVAP
DQLDLLEKCLKNIHRIDLKTKIQKYKQLEHHHHHH

Ligand information

>7dee Chain B (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DFSRNLYD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7dee Backbone and side-chain chemical shift assignments of a cellular FLICE-inhibitory protein (c-FLIPS)
Resolution	N/A
Binding residue (original residue number in PDB)	V9 V56 G57 L76 K77 M78 D79 H86
Binding residue (residue number reindexed from 1)	V9 V56 G57 L76 K77 M78 D79 H86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0042981	regulation of apoptotic process

View graph for
Biological Process

External links

PDB	RCSB:7dee, PDBe:7dee, PDBj:7dee
PDBsum	7dee
PubMed
UniProt	O15519\|CFLAR_HUMAN CASP8 and FADD-like apoptosis regulator (Gene Name=CFLAR)

[Back to BioLiP]