Structure of PDB 7de9 Chain A Binding Site BS01

Receptor Information
>7de9 Chain A (length=58) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGESLVGSRIKVWWPMDQAYYKGVVESYDAAKKKHLVIYDDGDQEILYL
KNQKWSPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7de9 A histone H3K4me1-specific binding protein is required for siRNA accumulation and DNA methylation at a subset of loci targeted by RNA-directed DNA methylation.
Resolution1.711 Å
Binding residue
(original residue number in PDB)		W616 M618 D619 Y623 Y641 D643 D645 E647 Q654
Binding residue
(residue number reindexed from 1)		W15 M17 D18 Y22 Y40 D42 D44 E46 Q53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007064 mitotic sister chromatid cohesion

View graph for
Biological Process
External links
PDB RCSB:7de9, PDBe:7de9, PDBj:7de9
PDBsum7de9
PubMed34099688
UniProtQ8GUP3|PDS5C_ARATH Sister chromatid cohesion protein PDS5 homolog C (Gene Name=PDS5C)

[Back to BioLiP]