Structure of PDB 7dct Chain A Binding Site BS01

Receptor Information
>7dct Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKH
NNMASFVRQLNMYGFRKVVHDTEFQHPCFLRGQEQLLENIKRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dct Structures of heat shock factor trimers bound to DNA.
Resolution2.36 Å
Binding residue
(original residue number in PDB)		K62 R71 N74 R79 K80
Binding residue
(residue number reindexed from 1)		K49 R58 N61 R66 K67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dct, PDBe:7dct, PDBj:7dct
PDBsum7dct
PubMed34458700
UniProtQ00613|HSF1_HUMAN Heat shock factor protein 1 (Gene Name=HSF1)

[Back to BioLiP]