Structure of PDB 7dci Chain A Binding Site BS01

Receptor Information
>7dci Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHN
NMASFVRQLNMYGFRKVVNGPVEFQHPYFKQGQDDLLENIKRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dci Crystal structure of HSF2 DNA-binding domain in complex with 2-site HSE DNA in the head-to-head orientation
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K54 R63 N66 R71 K110
Binding residue
(residue number reindexed from 1)		K48 R57 N60 R65 K93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dci, PDBe:7dci, PDBj:7dci
PDBsum7dci
PubMed
UniProtQ03933|HSF2_HUMAN Heat shock factor protein 2 (Gene Name=HSF2)

[Back to BioLiP]