Structure of PDB 7dc6 Chain A Binding Site BS01

Receptor Information
>7dc6 Chain A (length=275) Species: 9646 (Ailuropoda melanoleuca) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDSASRRMEPRAP
WIEQEGPEYWDRNTRIAEDNAQAFRVDLQTALRYYNQSEAGSHTIQWMHG
CDVGPDGRLLRGYSQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEAA
GEAERYRNYVEGECVEWLRRYLENGKETLQRAETPDTRVTRHPISDQKVT
LRCWALGFYPAEITLTWQQDGEDLTQDTELVETRPAGDGTFQKWAAVVVP
SGQEQRYTCHVQHEGLPEPLTRSWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dc6 Crystal structure of the giant panda MHC class I complex: First insights into the viral peptide presentation profile in the bear family.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		M6 Y8 N64 I67 D70 N71 A74 D78 T81 Y85 Y124 T144 K147 W148 E153 R156 Y157 Y160 W168 Y172
Binding residue
(residue number reindexed from 1)		M5 Y7 N63 I66 D69 N70 A73 D77 T80 Y84 Y123 T143 K146 W147 E152 R155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links