Structure of PDB 7d98 Chain A Binding Site BS01

Receptor Information

>7d98 Chain A (length=285) Species: 106590 (Cupriavidus necator) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLLTA
AGHAFLEDARRILELAGRSGDRSRAAARGDVGELSVAYFGTPIYRSLPLL
LRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVN
IAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGL
FKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVAAIRWPDIAFARI
VGTRVKVPISCIFRKEKQPPILARFVEHVRRSAKD

Ligand information

>7d98 Chain G (length=33) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tattacgcaaaccgtggtattggacggcatggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7d98 Crystal structure of the full-length LysR-type transcription regulator CbnR in complex with promoter DNA.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	S28 P31
Binding residue (residue number reindexed from 1)	S27 P30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7d98, PDBe:7d98, PDBj:7d98
PDBsum	7d98
PubMed	33576566
UniProt	Q9WXC7

[Back to BioLiP]