Structure of PDB 7d8o Chain A Binding Site BS01

Receptor Information
>7d8o Chain A (length=163) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKFFTISSSYIKYLKDFDDKVPNSEDPTYNNPKAFIGIVLEIEGHKYLA
PLTSPKAWHANVKESSPAFFKLHENGVPDNQLGLINLKFMIPIIEAEVSL
LDLDSMPDTPYKRMLYKQLQFIRVNEDKISEKSKLLRNLALQGRMQGTCD
FAVLEEKYQHFGK
Ligand information
>7d8o Chain B (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auuuaggugauuugcuaccuuuaagugcagcuagaaa
....<<<<...((((.>>>>......)))).......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d8o Identification, functional characterization, assembly and structure of ToxIN type III toxin-antitoxin complex from E. coli.
Resolution2.097 Å
Binding residue
(original residue number in PDB)
D19 K20 P22 N23 W57 N60 E63 S65 P66 K87 F88 L134 R143 M144 Q145
Binding residue
(residue number reindexed from 1)
D20 K21 P23 N24 W58 N61 E64 S66 P67 K88 F89 L135 R144 M145 Q146
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 13:35:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7d8o', asym_id = 'A', bs = 'BS01', title = 'Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7d8o', asym_id='A', bs='BS01', title='Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0004521', uniprot = '', pdbid = '7d8o', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004521', uniprot='', pdbid='7d8o', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>