Structure of PDB 7d8d Chain A Binding Site BS01

Receptor Information
>7d8d Chain A (length=232) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVPADSHIKYEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFL
RKLKSRMLPQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIE
QMHVELAELKDKGQIGQIYEVGMQDWTPDAGKYWLIWCQWCVGHLPDAEL
VAFLKRCIVGLQPNGTIVVKENNTPTDTDDFDETDSSVTRSDAKFRQIFE
EAGLKLIASERQRGLPRELYPVRMYALKPMPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d8d Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae
Resolution1.05 Å
Binding residue
(original residue number in PDB)		W18 L29 Y32 W140 P175 D182 D185 E218 L219 Y220
Binding residue
(residue number reindexed from 1)		W18 L29 Y32 W140 P175 D182 D185 E218 L219 Y220
Enzymatic activity
Enzyme Commision number 2.1.1.244: protein N-terminal methyltransferase.
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0071885 N-terminal protein N-methyltransferase activity
Biological Process
GO:0002181 cytoplasmic translation
GO:0006480 N-terminal protein amino acid methylation
GO:0032259 methylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d8d, PDBe:7d8d, PDBj:7d8d
PDBsum7d8d
PubMed
UniProtP38340|NTM1_YEAST Alpha N-terminal protein methyltransferase 1 (Gene Name=TAE1)

[Back to BioLiP]