Structure of PDB 7d6r Chain A Binding Site BS01

Receptor Information

>7d6r Chain A (length=282) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

REFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSVSVINHTPPGSYF
AVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHISV
PGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTM
TRDASRAVLRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTL
NWGRISNVLPEYRGEDGVRVGRISFNNISAILGTVAVILNCQPECQITGD
RPVIKINNTLWESNTAAAFLNRKSQFLYTTGK

Ligand information

>7d6r Chain G (length=5) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RRRRA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7d6r Identification of a peptide motif that potently inhibits two functionally distinct subunits of Shiga toxin.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	Y77 V78 D94 F95 S112 Y114 T115 E167 T199
Binding residue (residue number reindexed from 1)	Y77 V78 D94 F95 S112 Y114 T115 E167 T199

Enzymatic activity

Enzyme Commision number

3.2.2.22: rRNA N-glycosylase.

Gene Ontology

	Molecular Function
GO:0016787	hydrolase activity
GO:0030598	rRNA N-glycosylase activity
GO:0090729	toxin activity

	Biological Process
GO:0017148	negative regulation of translation
GO:0035821	modulation of process of another organism

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7d6r, PDBe:7d6r, PDBj:7d6r
PDBsum	7d6r
PubMed	33972673
UniProt	Q8XBV2

[Back to BioLiP]