Structure of PDB 7d6f Chain A Binding Site BS01

Receptor Information
>7d6f Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTSDVVIHRKENEGFGFVIISSLATITVPHKIGRIIDGSPADRCAKLKVG
DRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d6f Crystal structure of the PDZ4 domain of MAGI2 in complex with PBM of ARMS reveals a canonical PDZ recognition mode.
Resolution3.001 Å
Binding residue
(original residue number in PDB)
F930 G931 F932 V933 I934 I935 S936 S937 H987
Binding residue
(residue number reindexed from 1)
F15 G16 F17 V18 I19 I20 S21 S22 H66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7d6f, PDBe:7d6f, PDBj:7d6f
PDBsum7d6f
PubMed34371146
UniProtQ9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)

[Back to BioLiP]