Structure of PDB 7d0e Chain A Binding Site BS01

Receptor Information
>7d0e Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALD
LKPGSRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d0e Phosphorylation regulates the binding of autophagy receptors to FIP200 Claw domain for selective autophagy initiation.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		E1561 K1562 E1563 Y1564 C1565 Q1566 A1567 K1568 K1569 N1572 R1573 K1581 R1584
Binding residue
(residue number reindexed from 1)		E66 K67 E68 Y69 C70 Q71 A72 K73 K74 N77 R78 K86 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000045 autophagosome assembly

View graph for
Biological Process
External links
PDB RCSB:7d0e, PDBe:7d0e, PDBj:7d0e
PDBsum7d0e
PubMed33692357
UniProtQ8TDY2|RBCC1_HUMAN RB1-inducible coiled-coil protein 1 (Gene Name=RB1CC1)

[Back to BioLiP]