Structure of PDB 7cvo Chain A Binding Site BS01

Receptor Information
>7cvo Chain A (length=130) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEE
NKRRTLQKNDIAAAITRTDIFDFLVDIVPRVTQLSPMDREARVLRYREKR
KTRKFEKTIRYASRKAYAEIRPRVNGRFAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cvo Structural insights into the multivalent binding of the Arabidopsis FLOWERING LOCUS T promoter by the CO-NF-Y master transcription factor complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K85 M96 I97 A99 K324 I326 R327 Y328 R331 K332 E336 R340 N342 G343 F345
Binding residue
(residue number reindexed from 1)		K9 M20 I21 A23 K107 I109 R110 Y111 R114 K115 E119 R123 N125 G126 F128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7cvo, PDBe:7cvo, PDBj:7cvo
PDBsum7cvo
PubMed33693873
UniProtQ39057|CONS_ARATH Zinc finger protein CONSTANS (Gene Name=CO);
Q9FMV5

[Back to BioLiP]