Structure of PDB 7cui Chain A Binding Site BS01

Receptor Information
>7cui Chain A (length=173) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEITAHVINEPASLKLTTISTILHNLLKPRKHRLRVQVVDFWPKSLTQFA
VLSQPPSSYVWMFALLVRDVSNVTLPVIFFDSDAAELINSSKIQPCNLAD
HPQMTLQLKERLFLIWGNLEERIQHHISKGESPTLAAEDVETPWFDIYVK
EYIPVISLTFLQKRWRGFGTKIV
Ligand information
>7cui Chain B (length=28) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FHWKNMTSLSIEECIIPKGQQLILEKES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cui Structural insights into Pot1-ssDNA, Pot1-Tpz1 and Tpz1-Ccq1 Interactions within fission yeast shelterin complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L394 P404 K406 D415 W417 M437 A439 L441 T449 P451 I453 F455 K525 Y527 I528 P529 R546 R548
Binding residue
(residue number reindexed from 1)		L23 P29 K31 D40 W42 M62 A64 L66 T74 P76 I78 F80 K150 Y152 I153 P154 R164 R166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7cui, PDBe:7cui, PDBj:7cui
PDBsum7cui
PubMed35849625
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]