Structure of PDB 7cuh Chain A Binding Site BS01

Receptor Information
>7cuh Chain A (length=305) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQ
SLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLL
HQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDK
EEQFALLLNKIWDEQTVSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLY
VTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEG
DYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSR
KRLYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cuh Structural insights into Pot1-ssDNA, Pot1-Tpz1 and Tpz1-Ccq1 Interactions within fission yeast shelterin complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S58 L59 H60 T62 K63 D64 H86 F88 T111 Y115 R116 Q120 S123 K124 D125 K221 W223 Y224 Y232 F243 M245 T249 S252 R264 I266 W268 D269 L297 E301 H305 G306 D307 S308 R311 Y312
Binding residue
(residue number reindexed from 1)		S51 L52 H53 T55 K56 D57 H79 F81 T104 Y108 R109 Q113 S116 K117 D118 K189 W191 Y192 Y200 F211 M213 T217 S220 R232 I234 W236 D237 L265 E269 H273 G274 D275 S276 R279 Y280
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cuh, PDBe:7cuh, PDBj:7cuh
PDBsum7cuh
PubMed35849625
UniProtO13988|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]