Structure of PDB 7csz Chain A Binding Site BS01

Receptor Information
>7csz Chain A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIA
FVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEE
LTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYL
KPSQAAQAIENCDRSFRAILAEPKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7csz Structural basis for RNA recognition by the N-terminal tandem RRM domains of human RBM45.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R27 F29 V31 D53 W55 I68 F70 K100 Q105 R107 H112 D114
Binding residue
(residue number reindexed from 1)		R8 F10 V12 D34 W36 I49 F51 K81 Q86 R88 H93 D95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7csz, PDBe:7csz, PDBj:7csz
PDBsum7csz
PubMed33577684
UniProtQ8IUH3|RBM45_HUMAN RNA-binding protein 45 (Gene Name=RBM45)

[Back to BioLiP]