Structure of PDB 7cq4 Chain A Binding Site BS01

Receptor Information

>7cq4 Chain A (length=291) Species: 307796 (Saccharomyces cerevisiae YJM789)

QQHQFPDFYCCFLLQSINKRQSFYVGSTPNPVRRLRQHNGKLAKRDGSRP
WEMIMIVRGFPSKIAALQFEHAWQHGYQTHYIAEKDRVVKHKAGGRTLHH
KVALMKLLLKHEFFQRMNLIVEVFNIKAWEVWKQDKFFIERDRFPINIQI
NENALEEPKEKTVDVLMDHSDENLKVVEAVYTKVIENERNIFETFEKKLT
TGVVRCEICEKEIDYTSEEQNLKPFVALCNNKDCGCVNHLKCLHRYFLDD
EQLIVGRRNLIPRGGKCPKCDMFCDWTTLVKFSTRMKLAHG

Ligand information

>7cq4 Chain K (length=14)

aggacatctttgcc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7cq4 Structure specific DNA recognition by the SLX1-SLX4 endonuclease complex.
• Resolution: 3.294 Å
• Binding residue (original residue number in PDB): R39 H83
• Binding residue (residue number reindexed from 1): R34 H71

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000724 double-strand break repair via homologous recombination
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006310 DNA recombination
• GO:1902681 regulation of replication fork arrest at rDNA repeats
• GO:2000001 regulation of DNA damage checkpoint

Cellular Component

• GO:0000228 nuclear chromosome
• GO:0005634 nucleus
• GO:0033557 Slx1-Slx4 complex

External links

• PDB: RCSB:7cq4, PDBe:7cq4, PDBj:7cq4
• PDBsum: 7cq4
• PubMed: 34181713
• UniProt: P38324|SLX1_YEAST Structure-specific endonuclease subunit SLX1 (Gene Name=SLX1)