Structure of PDB 7cpo Chain A Binding Site BS01

Receptor Information
>7cpo Chain A (length=270) Species: 28377 (Anolis carolinensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHSMRYFVTSVSEPGQPFSYVGYVDDQEFVSYNASTRRYLPKVPWISKV
EKNDPDYWERNTLYAQGHERSFRDHLATLAEYYNQSGGLHTFQWMYGCEL
RNDWSKGGYYQYAYDGRDYISLDKDTLTWMAADVPAQNTKRKWDADFRDN
EYKKTYLEETCIEWLQRYLNYGKETLLRTEVPEVKVTRKEDYGMETLICR
VGGFYPKDIDIDWTRDGEVWLQDVFHGLVSPNSDGTYYTWRSVKVDPKER
ERYKCHVEHDGLPNPVDVAW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cpo The Crystal Structure of the MHC Class I (MHC-I) Molecule in the Green Anole Lizard Demonstrates the Unique MHC-I System in Reptiles.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 Y24 R63 N64 Y67 H71 H78 T81 Y85 F95 Y99 T142 K145 D149 D152 K156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y21 R60 N61 Y64 H68 H75 T78 Y82 F92 Y96 T139 K142 D146 D149 K153 Y156 W164 Y168
Enzymatic activity
Enzyme Commision number ?
External links