Structure of PDB 7co3 Chain A Binding Site BS01

Receptor Information

>7co3 Chain A (length=301) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSYANAVSRAAPAVANLYTTKMESSLGSAVIMSAEGYLLTNNHVTAGADQ
IIVALRDGRETIAQLVGSDPETDLAVLKIDLKNLPAMTLGRSDGIRTGDV
CLAIGNPFGVGQTVTMGIISATGRNQLGLNTYEDFIQTDAAINPGNAGGA
LVDAAGNLIGINTAIFSKSGGSQGIGFAIPTKLALEVMQSIIEHGQVIRG
WLGVEVKALTPELAESLGLGETAGIVVAGVYRDGPAARGGLLPGDVILTI
DKQEASDGRRSMNQVARTRPGQKISIVVLRNGQKVNLTAEVGLRPPPDGG
E

Ligand information

>7co3 Chain C (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WVF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7co3 Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	W281 L282 G283 V284 V286 K287 G338 S341 M342 R374
Binding residue (residue number reindexed from 1)	W201 L202 G203 V204 V206 K207 G258 S261 M262 R294

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008233	peptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7co3, PDBe:7co3, PDBj:7co3
PDBsum	7co3
PubMed	33622718
UniProt	Q9HVX1

[Back to BioLiP]