Structure of PDB 7co1 Chain A Binding Site BS01

Receptor Information
>7co1 Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLG
LLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQ
RYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTI
RMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGS
Ligand information
>7co1 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPAAVEAARQIEREAQQQQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7co1 Structural basis for transcriptional coactivator recognition by SMAD2 in TGF-beta signaling.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q388 V398 W448 Q455 M456
Binding residue
(residue number reindexed from 1)		Q124 V134 W184 Q191 M192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7co1, PDBe:7co1, PDBj:7co1
PDBsum7co1
PubMed33323411
UniProtQ15796|SMAD2_HUMAN Mothers against decapentaplegic homolog 2 (Gene Name=SMAD2)

[Back to BioLiP]