Structure of PDB 7cna Chain A Binding Site BS01

Receptor Information
>7cna Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGL
ELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDE
WRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDREPGE
VVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDL
VKTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cna Structural mechanism of bivalent histone H3K4me3K9me3 recognition by the Spindlin1/C11orf84 complex in rRNA transcription activation.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		W62 E64 W72 Y91 F94 D95 C96 Y98 F141 E142 W151 Y170 D173 Y177 Y179 D184 D189 H252
Binding residue
(residue number reindexed from 1)		W12 E14 W22 Y41 F44 D45 C46 Y48 F91 E92 W101 Y120 D123 Y127 Y129 D134 D139 H194
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:7cna, PDBe:7cna, PDBj:7cna
PDBsum7cna
PubMed33574238
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]