Structure of PDB 7clv Chain A Binding Site BS01

Receptor Information
>7clv Chain A (length=222) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGG
MHVDTARLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYG
TGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGN
NAGILALSYNIINSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGY
SSAMVAAACAVWCSVKKRLLEK
Ligand information
>7clv Chain C (length=25) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLSLRQSIRFFKPATRTLCSSRYLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7clv Solution structure of the voltage-gated Tim23 channel in complex with a mitochondrial presequence peptide.
ResolutionN/A
Binding residue
(original residue number in PDB)
D65 V68 E69 L71 E82
Binding residue
(residue number reindexed from 1)
D65 V68 E69 L71 E82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0022857 transmembrane transporter activity
GO:0030943 mitochondrion targeting sequence binding
Biological Process
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0030150 protein import into mitochondrial matrix
GO:0045039 protein insertion into mitochondrial inner membrane
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005744 TIM23 mitochondrial import inner membrane translocase complex
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7clv, PDBe:7clv, PDBj:7clv
PDBsum7clv
PubMed33318647
UniProtP32897|TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 (Gene Name=TIM23)

[Back to BioLiP]