Structure of PDB 7cis Chain A Binding Site BS01

Receptor Information
>7cis Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cis Phosphosite-dependent presentation of dual phosphorylated peptides by MHC class I molecules.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y7 H9 T24 E45 R62 E63 C67 D77 Y84 L95 Y99 D116 T143 K146 W147 Q155 L156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 H9 T24 E45 R62 E63 C67 D77 Y84 L95 Y99 D116 T143 K146 W147 Q155 L156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links