Structure of PDB 7cdb Chain A Binding Site BS01

Receptor Information
>7cdb Chain A (length=122) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLD
KRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLY
EDNHEEDYFLYVAYSDESVYGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cdb Structural basis of GABARAP-mediated GABA A receptor trafficking and functions on GABAergic synaptic transmission.
Resolution1.949 Å
Binding residue
(original residue number in PDB)		Y25 R28 L50
Binding residue
(residue number reindexed from 1)		Y30 R33 L55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008092 cytoskeletal protein binding
GO:0030957 Tat protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0043495 protein-membrane adaptor activity
Biological Process
GO:0006914 autophagy
GO:0061723 glycophagy
GO:0061753 substrate localization to autophagosome
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cdb, PDBe:7cdb, PDBj:7cdb
PDBsum7cdb
PubMed33436612
UniProtQ8R3R8|GBRL1_MOUSE Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=Gabarapl1)

[Back to BioLiP]