Structure of PDB 7cce Chain A Binding Site BS01

Receptor Information
>7cce Chain A (length=159) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THFNQFAYDGNTYDLEVPVLLVPEDKSQKPYVAIIKDITQTKDGSMMILG
QWFYRPEEAEKRGGGNWQSSDTRELFYSFHRDEVPAESVMHRCVVYFVPA
HKQLPKRKNNPGFIVRKVYDTVEKKLWKLTDKDYEDSKQREIDVLVKKTM
NVLGDLPDL
Ligand information
>7cce Chain P (length=12) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKAARKSAPATG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cce Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.
Resolution2.404 Å
Binding residue
(original residue number in PDB)		V140 P141 E142 Y149 W170 Y172 E176 H198 D200 V202 P203 E205 S206 T239 V240
Binding residue
(residue number reindexed from 1)		V22 P23 E24 Y31 W52 Y54 E58 H80 D82 V84 P85 E87 S88 T121 V122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:7cce, PDBe:7cce, PDBj:7cce
PDBsum7cce
PubMed33277495
UniProtQ8RXT5|AIPP3_ARATH ASI1-immunoprecipitated protein 3 (Gene Name=AIPP3)

[Back to BioLiP]