Structure of PDB 7c9o Chain A Binding Site BS01

Receptor Information

>7c9o Chain A (length=45) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMDREARVLRYREKKKARKFEKTIRYETRKAYAEARPRIKGRFAK

Ligand information

>7c9o Chain D (length=25) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aactcactctcaaccacagctcgat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7c9o Structural Insight into DNA Recognition by CCT/NF-YB/YC Complexes in Plant Photoperiodic Flowering.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	Y366 R370 R376 F377 A378 K379
Binding residue (residue number reindexed from 1)	Y32 R36 R42 F43 A44 K45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0009909	regulation of flower development

View graph for
Biological Process

External links

PDB	RCSB:7c9o, PDBe:7c9o, PDBj:7c9o
PDBsum	7c9o
PubMed	32843433
UniProt	Q9FDX8\|HD1_ORYSJ Zinc finger protein HD1 (Gene Name=HD1)

[Back to BioLiP]