Structure of PDB 7c6a Chain A Binding Site BS01

Receptor Information

>7c6a Chain A (length=373) Species: 562,9606

CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLVLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIWF
ITCMSVDRYQSVIYPFNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEY
LGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLL
KTNADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKAMKDF
RHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLKNRIT
RDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGN

Ligand information

>7c6a Chain B (length=8) Species: 9606 (Homo sapiens)

GRVYIHPI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7c6a The discovery of a new antibody for BRIL-fused GPCR structure determination.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): S36 Y103 Y104 Y108 R182 I187 E188 I196 M197 Y204 K215 D279 W283 D297 L300 I304
• Binding residue (residue number reindexed from 1): S2 Y69 Y70 Y74 R143 I148 E149 I157 M158 Y165 K176 D329 W333 D347 L350 I354

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004945 angiotensin type II receptor activity
• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006954 inflammatory response
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0022900 electron transport chain
• GO:0042981 regulation of apoptotic process
• GO:0097746 blood vessel diameter maintenance

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:7c6a, PDBe:7c6a, PDBj:7c6a
• PDBsum: 7c6a
• PubMed: 32669569
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
  P50052|AGTR2_HUMAN Type-2 angiotensin II receptor (Gene Name=AGTR2)