Structure of PDB 7c5d Chain A Binding Site BS01

Receptor Information
>7c5d Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHT
VSRLLRVMQCLSRIEEGENLDCSFDMLTPLESAINVLEMIKTEFTLTEAV
VESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDTTQKLRNDLLNIIR
EKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c5d Microcephalin 1/BRIT1-TRF2 interaction promotes telomere replication and repair, linking telomere dysfunction to primary microcephaly.
Resolution2.151 Å
Binding residue
(original residue number in PDB)		R80 Q84 L87 E94 S98 L101 R102 M104 Q105 R109 D117 C118 S119 F120
Binding residue
(residue number reindexed from 1)		R34 Q38 L41 E48 S52 L55 R56 M58 Q59 R63 D71 C72 S73 F74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c5d, PDBe:7c5d, PDBj:7c5d
PDBsum7c5d
PubMed33203878
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]